Molecular Neurobiology: Proceedings of the First NIMH ConferenceU.S. Department of Health and Human Services, Public Health Service, Alcohol, Drug Abuse, and Mental Health Administration, National Institute of Mental Health, 1989 - Всего страниц: 348 |
Результаты поиска по книге
Результаты 1 – 5 из 100
Стр. xv
... Regional Expression of GABA / Benzodiazepine Receptors , the Proto - Oncogene C - Fos and Calbindin D28 in Tissue Sections J.M. Séquier , P. Malherbe , W. Hunziker , H. Möhler , and J.G. Richards 292 Signal ... Region Genes In XV.
... Regional Expression of GABA / Benzodiazepine Receptors , the Proto - Oncogene C - Fos and Calbindin D28 in Tissue Sections J.M. Séquier , P. Malherbe , W. Hunziker , H. Möhler , and J.G. Richards 292 Signal ... Region Genes In XV.
Стр. xvi
... Region Contains Neuron - Specific Transcriptional Signals . N. Mori , R. Stein , and D.J. Anderson Synapsin I : Purification and Characterization of Actin and Tubulin Binding Domains T.C. Petrucci , G. Macchia , P. Macioce , J.S. Morrow ...
... Region Contains Neuron - Specific Transcriptional Signals . N. Mori , R. Stein , and D.J. Anderson Synapsin I : Purification and Characterization of Actin and Tubulin Binding Domains T.C. Petrucci , G. Macchia , P. Macioce , J.S. Morrow ...
Стр. 15
... region for the gamma subunit ( Gardner et al . 1987 ) . The goal of these studies is to understand how electrical activity can regulate the promoters of specific genes . The isolation of cDNA clones coding for the muscle nicotinic ...
... region for the gamma subunit ( Gardner et al . 1987 ) . The goal of these studies is to understand how electrical activity can regulate the promoters of specific genes . The isolation of cDNA clones coding for the muscle nicotinic ...
Стр. 16
Proceedings of the First NIMH Conference. SIGNAL PEPTIDE DITYHFVMQRLPLYFIVNVIIPCLLFSFLT PTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIC IDT IPNIMFFSTMKRPSRDKQEKRIFTEDIDISDISGKPGPPPMGFH CYTOPLASMIC REGION ... REGION AMPHIPATHIC HELIX consistent with ...
Proceedings of the First NIMH Conference. SIGNAL PEPTIDE DITYHFVMQRLPLYFIVNVIIPCLLFSFLT PTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIC IDT IPNIMFFSTMKRPSRDKQEKRIFTEDIDISDISGKPGPPPMGFH CYTOPLASMIC REGION ... REGION AMPHIPATHIC HELIX consistent with ...
Стр. 17
... regions , and the proposed amphipathic helix are indicated below the aligned sequences . The mature alpha 2 protein has 49 , 57 , and 67 percent amino acid sequence identity with the mature alpha 1 , alpha 3 and alpha 4 proteins ...
... regions , and the proposed amphipathic helix are indicated below the aligned sequences . The mature alpha 2 protein has 49 , 57 , and 67 percent amino acid sequence identity with the mature alpha 1 , alpha 3 and alpha 4 proteins ...
Другие издания - Просмотреть все
Часто встречающиеся слова и выражения
Academy of Sciences activity adhesion molecules alpha amino acid antibodies Aplysia arachidonic acid astrocytes axons basal basal lamina behavior binding brain cDNA cDNA clones cell adhesion Cell Biology cellular chick cholinergic components culture Developmental Drosophila embryonic encoding expression fasciclin function G protein ganglion gene genetic glycoproteins growth cones hormone hybridization identified iK.ACh integrin interactions intracellular Journal of Cell Journal of Neuroscience ligand mammalian mechanisms mediated membrane metabolites molecular motor neurons mRNA muscle mutations National Academy nerve growth factor nervous system neural neurite neurite outgrowth Neurobiology neuropeptide Neuroscience neurotransmitter nicotinic acetylcholine receptor nicotinic receptor NMDA pathway peptide Ph.D phosphorylation Physiology Piomelli postsynaptic potassium channel potentiation precursor presynaptic processes protein kinase region regulation Reichardt release response role School of Medicine Schwann cells sensory neurons sequence Shaker signal specific spinal cord structure studies substrate subunits synaptic vesicles synthesis tion tissue transcription University vitro
Популярные отрывки
Стр. 157 - Rosenfeld, MG, Mermod, JJ, Amara, SG, Swanson, LW, Sawchenko, PE, Rivier, J., Vale, WW, and Evans, RM 1983. Production of a novel neuropeptide encoded by the calcitonin gene via tissue-specific RNA processing.
Стр. 188 - D'Ercole AJ, Stiles AD, Underwood LE. Tissue concentrations of somatomedin C: further evidence for multiple sites of synthesis and paracrine or autocrine mechanisms of action. Proc Natl Acad Sci USA 1984; 81:935-939.
Стр. 68 - H. (1983). Excitatory amino acids in synaptic transmission in the Schaffer collateral-commissural pathway of the rat hippocampus.
Стр. 223 - RAFF MC, MILLER RH, NOBLE M. A glial progenitor cell that develops in vitro into an astrocyte or an oligodendrocyte depending on culture medium. Nature 303...
Стр. xxxvi - Mount Sinai School of Medicine, One Gustave L. Levy Place, New York, NY 10029.
Стр. 125 - Identification and isolation of a 140 kd cell surface glycoprotein with properties expected of a fibronectin receptor. Cell 40, 191-198.
Стр. 156 - Expression in brain of a messenger RNA encoding a novel neuropeptide homologous to calcitonin gene-related peptide. Science 229, 1094-1097.
Стр. 49 - GL 1987. The physiology of excitatory amino acids in the vertebrate central nervous system. Prog. Neurobiol. 28: 197-276.
Стр. 149 - Nawa, H., Hirose, T., Takashima, H., Inayama, S., and Nakanishi, S. (1983). Nucleotide sequences of cloned cDNAs for two types of bovine brain substance P precursor. Nature 306, 32-36.
Стр. 126 - Seilheimer, B. , and Schachner, M. (1988) Studies of adhesion molecules mediating interactions between cells of peripheral nervous system indicate a major role for LI in mediating sensory neuron growth on Schwann cells in culture.